PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00984.1.g00040.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MIKC_MADS
Protein Properties Length: 246aa    MW: 27563.7 Da    PI: 9.5397
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00984.1.g00040.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.51.2e-30959151
                                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                  krien++ rqvtf+kRrng+lKKA+ELSvLCd+eva+i+fss+g+lyeys+
  Zpz_sc00984.1.g00040.1.sm.mk  9 KRIENTTSRQVTFCKRRNGLLKKAYELSVLCDVEVALIVFSSRGRLYEYSN 59
                                  79***********************************************95 PP

2K-box84.32.6e-2878164489
                         K-box   4 ssgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkk 83 
                                   ssg+  le++ ++++qqe+akL+++i++Lq+++ hl+G+++++LslkeL+qLe++Leks+ kiR++K+ell ++i+++ k+
  Zpz_sc00984.1.g00040.1.sm.mk  78 SSGTPlLETNAQQYYQQESAKLRNQIQMLQNTNMHLVGDSVGNLSLKELKQLESRLEKSIAKIRARKSELLASEISYMVKR 158
                                   556666888999******************************************************************888 PP

                         K-box  84 ekelqe 89 
                                    +++ +
  Zpz_sc00984.1.g00040.1.sm.mk 159 GEQQIQ 164
                                   665443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.067161IPR002100Transcription factor, MADS-box
SMARTSM004321.6E-40160IPR002100Transcription factor, MADS-box
CDDcd002652.96E-45274No hitNo description
SuperFamilySSF554554.71E-32274IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.5E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-313859IPR002100Transcription factor, MADS-box
PfamPF014863.7E-2085165IPR002487Transcription factor, K-box
PROSITE profilePS5129712.28889182IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048283Biological Processindeterminate inflorescence morphogenesis
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MGRGRIEIKR IENTTSRQVT FCKRRNGLLK KAYELSVLCD VEVALIVFSS RGRLYEYSNN  60
SVRATIERYK KAHACGSSSG TPLLETNAQQ YYQQESAKLR NQIQMLQNTN MHLVGDSVGN  120
LSLKELKQLE SRLEKSIAKI RARKSELLAS EISYMVKRGE QQIQQVTVAQ STAAAISMEQ  180
LNPFTVLDTK CFFPAAPFAA LDMKCFLPGT LQLLEAQNQM LATELNLGYQ QIPAPPPGTD  240
VANHQF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-20186187Myocyte-specific enhancer factor 2B
1tqe_Q4e-20186187Myocyte-specific enhancer factor 2B
1tqe_R4e-20186187Myocyte-specific enhancer factor 2B
1tqe_S4e-20186187Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0366951e-145BT036695.1 Zea mays full-length cDNA clone ZM_BFb0132D15 mRNA, complete cds.
GenBankBT0625371e-145BT062537.1 Zea mays full-length cDNA clone ZM_BFb0311H16 mRNA, complete cds.
GenBankBT0844371e-145BT084437.1 Zea mays full-length cDNA clone ZM_BFb0113P24 mRNA, complete cds.
GenBankKJ7275641e-145KJ727564.1 Zea mays clone pUT5424 MADS transcription factor (MADS2) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105379.21e-140uncharacterized protein LOC542326
SwissprotQ2QW531e-109MAD13_ORYSJ; MADS-box transcription factor 13
TrEMBLB4FPN61e-140B4FPN6_MAIZE; Uncharacterized protein
STRINGSi022981m1e-138(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.13e-75MIKC_MADS family protein